Protein Info for MPMX26_01139 in Acinetobacter radioresistens SK82

Annotation: Hydroxyacylglutathione hydrolase GloB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 10 to 235 (226 residues), 307.7 bits, see alignment E=2.8e-96 PF00753: Lactamase_B" amino acids 14 to 173 (160 residues), 64.4 bits, see alignment E=1.5e-21 PF16123: HAGH_C" amino acids 174 to 243 (70 residues), 73 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 51% identical to GLO2_HERAR: Hydroxyacylglutathione hydrolase (gloB) from Herminiimonas arsenicoxydans

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 72% identity to aci:ACIAD2452)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>MPMX26_01139 Hydroxyacylglutathione hydrolase GloB (Acinetobacter radioresistens SK82)
MTYKVHCIDVKNQLQNYIWILEDSSTKEAVVVDPTEAQLVQDFCQTRNLILSQIWLTHWH
KDHIGGVPELITERNIPVYGPREELSHIPFISHPLQHENHFKFNHLKVDILAVPGHTLGH
IVYFIDELDILFCGDTLFAMGCGRVFEGTYAQMYHSLNRLAALPPRTQVYCTHEYTLSNA
EFALTVEPDNLALHSRVEQVRKMRDSHQCTLPTTIALELETNPFLRAESEEEFSRIRILK
DNF