Protein Info for MPMX26_01129 in Acinetobacter radioresistens SK82

Annotation: tRNA N6-adenosine threonylcarbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 3 to 312 (310 residues), 439.8 bits, see alignment E=5.2e-136 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 304 (301 residues), 391.7 bits, see alignment E=2.2e-121 PF00814: TsaD" amino acids 25 to 305 (281 residues), 331.3 bits, see alignment E=8.5e-103 PF22521: HypF_C_2" amino acids 217 to 300 (84 residues), 37.6 bits, see alignment E=3.3e-13 PF02543: Carbam_trans_N" amino acids 223 to 278 (56 residues), 24.8 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 90% identical to TSAD_ACIB5: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Acinetobacter baumannii (strain AB0057)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 90% identity to acd:AOLE_05830)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX26_01129 tRNA N6-adenosine threonylcarbamoyltransferase (Acinetobacter radioresistens SK82)
MIVLGLETSCDETGLALYDSEQGLRGQVLYSQIKLHAEYGGVVPELASRDHVRKLIPLLD
ELLIQSGVKKTEIDAVAYTRGPGLMGALMTGALFGRTLAFALNKPAIGVHHMEGHMLAPL
LSDTPPEFPFVALLVSGGHSQLMAAYGIGQYELLGESIDDAAGEAFDKVAKMMDLPYPGG
PNIARLAQQGNPTAFDFPRPMLHQGLTFSFSGLKTAVSVQLKKVEGQNREADIAASFQEA
IVDTLVKKSVKALKQTGLNRLVIAGGVSANQRLREQLESSLNRIKASVYYAEPALCTDNG
AMIAFAGYQRLKAGQQDGLSVTTTPRWPMTELTRPTEI