Protein Info for MPMX26_01109 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details PF04241: DUF423" amino acids 16 to 102 (87 residues), 88.2 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: None (inferred from 81% identity to abm:ABSDF1263)

Predicted SEED Role

"COG2363"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>MPMX26_01109 hypothetical protein (Acinetobacter radioresistens SK82)
MWIAISALNLALAVMVGAFGAHGLKTRASEAQLAWWHTATEYFFYHALGLLILGVISKTL
PQLPIKGSFLLIQFGIFLFCGSLYIMALGLPRGLGAITPIGGALMIGGWLLLAWNAFKYL
R