Protein Info for MPMX26_01095 in Acinetobacter radioresistens SK82

Annotation: Protein YhfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 43 to 60 (18 residues), see Phobius details PF02566: OsmC" amino acids 33 to 132 (100 residues), 75.7 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 48% identical to YHFA_ECOLI: Protein YhfA (yhfA) from Escherichia coli (strain K12)

KEGG orthology group: K07397, putative redox protein (inferred from 93% identity to acd:AOLE_13515)

Predicted SEED Role

"OsmC/Ohr family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>MPMX26_01095 Protein YhfA (Acinetobacter radioresistens SK82)
MQTSVHWLENVAFEAKSESGHSVIMDGSAEYGGENRGPRPMELILMGLGGCASFDIVTIL
KKSRQDIQDVVCQLKAERADTIPAVFTKIHLHFVVTGKDIKEKQVAKAVELSAEKYCSAS
KMLSDGGVEITHDYEIIETV