Protein Info for MPMX26_01079 in Acinetobacter radioresistens SK82

Annotation: Adenine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR01430: adenosine deaminase" amino acids 10 to 329 (320 residues), 419.7 bits, see alignment E=3.6e-130 PF00962: A_deaminase" amino acids 11 to 330 (320 residues), 332.8 bits, see alignment E=2.2e-103 PF19326: AMP_deaminase" amino acids 191 to 327 (137 residues), 35.1 bits, see alignment E=5.5e-13

Best Hits

Swiss-Prot: 85% identical to ADE_ACIAD: Adenine deaminase (ACIAD1245) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 85% identity to aci:ACIAD1245)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>MPMX26_01079 Adenine deaminase (Acinetobacter radioresistens SK82)
MSHTELIRALPKAELHVHIEGTFEPELMFEIAQRNQIDIPYKSVEEVRQAYNFHNLQSFL
DIYYAGANVLIHEEDFYDLAWAYFKKCAEDHVVHTEIFFDPQTHTDRGIAFETVLNGLQR
ACNDAKTKLGISSYLIMCFLRHLSEEAALKTLEQALPYKNQIIAVGLDSSEVGHPPAKFT
RVFAKAREAGFLVVAHAGEEGPPEYVWEALDLLKVNRIDHGVRSEEDPVLMQRLIQEKMP
LTVCPLSNLKLCVVDDMQQHNIHRLLQQGVKVTVNSDDPSYFGGYMNDNFFAIQKALNLS
EAELKQLAINSFEAAFIDNTEKQSWIKKIQAL