Protein Info for MPMX26_01079 in Acinetobacter radioresistens SK82

Annotation: Adenine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01430: adenosine deaminase
  • amino acids 10 to 329 (320 residues), 419.7 bits, E=3.6e-130
• PF00962: A_deaminase
  • amino acids 11 to 330 (320 residues), 332.8 bits, E=2.2e-103
• PF19326: AMP_deaminase
  • amino acids 191 to 327 (137 residues), 35.2 bits, E=5.1e-13

Best Hits

Swiss-Prot: 85% identical to ADE_ACIAD: Adenine deaminase (ACIAD1245) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 85% identity to aci:ACIAD1245)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenine and adenosine salvage III (4/4 steps found)
• purine deoxyribonucleosides degradation I (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• purine deoxyribonucleosides degradation II (3/3 steps found)
• purine ribonucleosides degradation (5/6 steps found)
• superpathway of purine deoxyribonucleosides degradation (5/7 steps found)
• adenine and adenosine salvage V (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Protein Sequence (332 amino acids)

>MPMX26_01079 Adenine deaminase (Acinetobacter radioresistens SK82)
MSHTELIRALPKAELHVHIEGTFEPELMFEIAQRNQIDIPYKSVEEVRQAYNFHNLQSFL
DIYYAGANVLIHEEDFYDLAWAYFKKCAEDHVVHTEIFFDPQTHTDRGIAFETVLNGLQR
ACNDAKTKLGISSYLIMCFLRHLSEEAALKTLEQALPYKNQIIAVGLDSSEVGHPPAKFT
RVFAKAREAGFLVVAHAGEEGPPEYVWEALDLLKVNRIDHGVRSEEDPVLMQRLIQEKMP
LTVCPLSNLKLCVVDDMQQHNIHRLLQQGVKVTVNSDDPSYFGGYMNDNFFAIQKALNLS
EAELKQLAINSFEAAFIDNTEKQSWIKKIQAL