Protein Info for MPMX26_01076 in Acinetobacter radioresistens SK82

Annotation: C4-dicarboxylic acid transporter DauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 12 to 17 (6 residues), see Phobius details transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 48 to 78 (31 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 353 to 382 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 143 (130 residues), 95.6 bits, see alignment E=4.4e-31 amino acids 166 to 357 (192 residues), 99.8 bits, see alignment E=2.3e-32 PF16983: MFS_MOT1" amino acids 231 to 332 (102 residues), 31 bits, see alignment E=4.3e-11 PF01740: STAS" amino acids 397 to 483 (87 residues), 45.6 bits, see alignment E=7.9e-16

Best Hits

Swiss-Prot: 58% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 81% identity to acd:AOLE_08025)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>MPMX26_01076 C4-dicarboxylic acid transporter DauA (Acinetobacter radioresistens SK82)
MLSSFREQWFSNIRADVLAGLVVGLALIPEAIAFSIIAGVDPQVGLYASFSMAVVIAIVG
GRPAMISAATGAMALVMVTLVKEHGLQYLLAATILTGIIQILAGYLKLAKLMRFVSKSVV
IGFVNALAILIFMAQLPELINVSWQVYLFVAVGLSIIYLFPYVPRLGSWLPSPLVCIVVI
SLLSIWLNSDIRTVGDMGTLPDSLPVFLIPDIPLNFETLRIILPYSIALAAVGLLESMMT
ASIVDEMTDTSSDKHQECKGQGIANIVTGFMGGMAGCAMIGQSMINVKSGGRQRLSTFCA
GIFLLILVVFISDWLKLIPMAALVAVMIMVSISTFNWQSVIQFHKNPKSSNSVMIATVVV
VVATHNLALGVLTGVLLSALFLANKLENDIRVESALKEGVRIYSLVGQIFFSSSERFYQS
FNFNEQVEKVIIDLTHSHIWDVTSVAMLDSVIKKFTERGTSCEVIGLNEASSIMIDKYGT
HAKI