Protein Info for MPMX26_01066 in Acinetobacter radioresistens SK82

Annotation: L-lysine 2,3-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00238: KamA family protein" amino acids 8 to 325 (318 residues), 326.3 bits, see alignment E=1.9e-101 TIGR03821: EF-P beta-lysylation protein EpmB" amino acids 11 to 332 (322 residues), 440.4 bits, see alignment E=3.3e-136

Best Hits

Swiss-Prot: 51% identical to EPMB_ECOLI: L-lysine 2,3-aminomutase (epmB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to aby:ABAYE1057)

MetaCyc: 51% identical to lysine 2,3-aminomutase (Escherichia coli K-12 substr. MG1655)
5.4.3.-

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX26_01066 L-lysine 2,3-aminomutase (Acinetobacter radioresistens SK82)
MINYLYQEQNWQSQLSDLITDPLELLHALQLSPEQLLSGAVLASEKFKLRVPRAFVAKMC
IGDPLDPLLLQVLPHHLELEDFPGFVTDPLGEEAANLLPGVLHKYKTRFLLTLTGACAVH
CRYCFRRHFPYQENLPKNEDWPAIKNYILSQPEVHEIILSGGDPLTLSNRKLGLWLERLE
SIPQIDTLRIHSRVPIVIPDRIDHELISLLENSRLRIILVVHSNHASELDDFTCSKLHEL
ARRQVTVLNQAVLLKGINDSAEVLINLSYRLFEARVMPYYLHVLDKVKGAHHFDLPSSKI
DEVYKEVLASLPGYLVPKLVREIAGEKNKTPLFGTITI