Protein Info for MPMX26_01061 in Acinetobacter radioresistens SK82

Annotation: Lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00068: lactoylglutathione lyase" amino acids 2 to 130 (129 residues), 222.5 bits, see alignment E=7.8e-71 PF00903: Glyoxalase" amino acids 3 to 123 (121 residues), 98.5 bits, see alignment E=5.4e-32 PF13669: Glyoxalase_4" amino acids 5 to 105 (101 residues), 37.7 bits, see alignment E=3.4e-13 PF18029: Glyoxalase_6" amino acids 8 to 123 (116 residues), 24.3 bits, see alignment E=6.3e-09

Best Hits

Swiss-Prot: 79% identical to LGUL_NEIMB: Lactoylglutathione lyase (gloA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 92% identity to acd:AOLE_05015)

MetaCyc: 64% identical to lactoylglutathione lyase (Escherichia coli K-12 substr. MG1655)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>MPMX26_01061 Lactoylglutathione lyase (Acinetobacter radioresistens SK82)
MRMLHTMLRVGNLEQSLKFYTEVLGMTLLRKRDYEEGRFTLAFVGYGDEANHTVLELTHN
WDTESYELGNAYGHIAIAVEDAYKACEEIKARGGNVVREAGPMKGGVTVIAFVEDPDGYK
IELIQQDDNARNN