Protein Info for MPMX26_01050 in Acinetobacter radioresistens SK82

Annotation: Protein YrdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF00132: Hexapep" amino acids 97 to 130 (34 residues), 33 bits, see alignment 1.7e-12

Best Hits

Swiss-Prot: 59% identical to YRDA_ECOLI: Protein YrdA (yrdA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to abc:ACICU_02643)

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>MPMX26_01050 Protein YrdA (Acinetobacter radioresistens SK82)
MNNNIRSYLEHTPQVDNSCYIDSMAVVIGDVHLAENVSVWPFAVVRGDVNSIRIGKNSNV
QDHCMLHVSHKKADKPEGSPLIIGEDVTIGHHVILHGCTIGNRVLVGIKTVILDDVIIED
DVMIGAGSLVPPRKRLESGYLYVGSPVQKVRPLTDKEKEFLPYSARHYVKVANNYQEN