Protein Info for MPMX26_01045 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 52 (18 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details PF09997: DUF2238" amino acids 43 to 191 (149 residues), 136.6 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: K08984, putative membrane protein (inferred from 58% identity to acd:AOLE_04945)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>MPMX26_01045 hypothetical protein (Acinetobacter radioresistens SK82)
MIDYHLHAKHWGVFIILALAVMIASIHPMELSSYLLHQLGTLLMWIALIILIKKIGLGFG
SVTSYIIFLLIHVLGAHYLYSYVPYNEWFIQLSGIDLNQMMGWQRNMYDRLVHFAYGLLL
YPVFLRLHQVWLPDLKPWIWFILVIESVMSTSLIYEWIEWLIAINLSPEAAENYNGQQGD
IWDAHKDILLATLGAIMTGIIVLIKENYKTLLNRS