Protein Info for MPMX26_01040 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 244 to 271 (28 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details PF11812: DUF3333" amino acids 33 to 196 (164 residues), 118.3 bits, see alignment E=3.4e-38 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 221 to 462 (242 residues), 214.4 bits, see alignment E=8.3e-68 PF00528: BPD_transp_1" amino acids 261 to 460 (200 residues), 63.9 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 83% identity to aci:ACIAD1214)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>MPMX26_01040 hypothetical protein (Acinetobacter radioresistens SK82)
MSTSNTSPLGQKDIFDAQAAADLRAKRKDRIAKSLSKRHRKEKIFRIAGFSAVMAGLFFV
ALLFGSILIKGLPAFWQAGMSVPVYFDPNIIDAGPRPVQKAGESPAQFQGRYIAWQTKMG
MVDWDALIVNGIISKAPALAPQRDELGEIYTSSESYRLRDMVFENPALIGKTQDIKILAD
ANVDVWVRGQIDRDLPDEQQQLSPEVRKLADEMEAQGVLTTSFNTQIFTNPDSRSSPATS
GLAGAFMGSLFMMLIVIFISIPIGVASAIYLEEFAPKNYITDIIEVNINNLAAVPSIVFG
LLGAAIFIGWMHLPLSAPLVGGLVLSLMTLPTVIITTRASLKAVPPSIRQAALGLGASRV
QTIFHHVLPLALPGILTGAIIGVAQALGETAPLLLIGMSAFVASVPTSPLDQSTALPVQI
FLWQGNELRNFFEGRTAAAIIVLLALMIGLNSLAIWLRKKFEVRW