Protein Info for MPMX26_01037 in Acinetobacter radioresistens SK82

Annotation: Aromatic amino acid transport protein AroP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 401 to 419 (19 residues), see Phobius details amino acids 426 to 444 (19 residues), see Phobius details PF00324: AA_permease" amino acids 16 to 448 (433 residues), 409.9 bits, see alignment E=1.4e-126 PF13520: AA_permease_2" amino acids 20 to 431 (412 residues), 119.2 bits, see alignment E=2.2e-38

Best Hits

Swiss-Prot: 64% identical to AROP_ECOL6: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 82% identity to aby:ABAYE1031)

MetaCyc: 64% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>MPMX26_01037 Aromatic amino acid transport protein AroP (Acinetobacter radioresistens SK82)
MDTNQNTLKKGLSNRHIQLIALGGAIGTGLFLGISQTIKLAGPSVLLGYAIAGIIAFLIM
RQLGEMVVEEPVSGSFSYFANKYWGRMAGFMSGWNYWVLYVLVSMAELSAIGTFIQFWWP
EIPTWITAMGFFILINGINFINVRFFGETEFLFSCIKIIAILSMIGFGAYLLFSGAAGPE
AGIANLWQHGGFFPNGISGLVMAMAAIMFAFGGLELIGIAAAETQNPEKNIPKATNQIVY
RILIFYIGAIGILLSLYPWNQVAQGGSPFVLIFQSLNNHSVANVLNLVVLIAAVSVYNSC
IYCNSRMLHGLAEQGNAPQFLKKVNRRGIPVAALAVSGSITALCVVINYIIPEKAFGFLM
MLVVAALVINWLMISVTHLKFVKVMKQQHRLTAFKAIASPWTNYLTIAFMFFILTIMSLT
PDMRSAVILAPVWLSALAIMYFVYYRKRNVVLTGGIQPNP