Protein Info for MPMX26_01030 in Acinetobacter radioresistens SK82

Annotation: NADPH oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00970: FAD_binding_6" amino acids 54 to 134 (81 residues), 28.7 bits, see alignment E=2.7e-10 PF08030: NAD_binding_6" amino acids 140 to 223 (84 residues), 32.8 bits, see alignment E=1.4e-11 PF00175: NAD_binding_1" amino acids 144 to 241 (98 residues), 43.2 bits, see alignment E=1.1e-14 PF00111: Fer2" amino acids 272 to 320 (49 residues), 24.3 bits, see alignment 4.9e-09

Best Hits

KEGG orthology group: None (inferred from 60% identity to acd:AOLE_04855)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>MPMX26_01030 NADPH oxidoreductase (Acinetobacter radioresistens SK82)
MQALKKQHSPLSFLTSSVFDTDAANFWLKKLNPLWSVNQSLGQIVYKEKAANGIFSLKIK
CNRHFRMGQAGQHHPVFIEIDGRRYERSYSLHRIDEQHVLLTAKQVEQGVVSNWLAEHAQ
VGDLVEFGQPYGDMILPEASNLVLLAAGSGITPMLSMIETWAKQPDALAKVQLLYWVKDY
EDAAFEENFKKVAENNDNFSFQIFYTQQTDQRLNTEHLSLVSQPEQSAVYACGPSGFVSL
AEELFSQAVLFKGEAFSLSQADSSDTGFVNITLLQSEKTVAIPKGQSILAGLEQMNLKPK
HGCRMGICNKCACNKVQGSTRNLVNGAESTEPGNLLKLCVNSAQTDLVIDL