Protein Info for MPMX26_01022 in Acinetobacter radioresistens SK82

Annotation: Thiamine-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 4 to 183 (180 residues), 181.3 bits, E=6e-58
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 4 to 185 (182 residues), 160.9 bits, E=1.1e-51

Best Hits

Swiss-Prot: 45% identical to THIE_PSEFS: Thiamine-phosphate synthase (thiE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 75% identity to acd:AOLE_04820)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate salvage II (5/5 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiamine diphosphate salvage IV (yeast) (5/7 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (209 amino acids)

>MPMX26_01022 Thiamine-phosphate synthase (Acinetobacter radioresistens SK82)
MRGLYLITNDDPIELLLEKLEAALATHQIEILQYRRKKVEKADQLHEVERIKALCDFYKV
PLVINDDIRLAAQCGLGVHLGQTDGEIIEAKTQLPENMIIGRTCANSIELAEQAIADGAT
YIAFGAIYATYSKPEAGNIGLETLKLARQKFSLPICAIGGLKVENAQPVIQAGADLCAVI
SDILALPAEEIPSRVQAWAILFAETQPAI