Protein Info for MPMX26_01015 in Acinetobacter radioresistens SK82

Annotation: L-cystine uptake protein TcyP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF00375: SDF" amino acids 29 to 442 (414 residues), 351.1 bits, see alignment E=4.2e-109

Best Hits

Swiss-Prot: 79% identical to YDJN_ECOLI: L-cystine transporter YdjN (ydjN) from Escherichia coli (strain K12)

KEGG orthology group: K06956, (no description) (inferred from 91% identity to acd:AOLE_04785)

MetaCyc: 79% identical to cystine/sulfocysteine:cation symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-285; TRANS-RXN-286; TRANS-RXN-330; TRANS-RXN0-616

Predicted SEED Role

"L-cystine uptake protein TcyP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>MPMX26_01015 L-cystine uptake protein TcyP (Acinetobacter radioresistens SK82)
MNIPLIINIVVFIGLIFLLAQTRKTTWSLSKKVLAGLVLGVIFGLGLHAVYGANHPILAE
SISWFNIVGNGYVKFLQMVVMPLVFVSILGAVAKLHQASSLGKISFYSIGTLLFTTLIAA
LVGVFVTNLFGLTAQGLVQGAAETARLNTIQSDYVGKLTDLSVPQLILSFIPSNPFAELT
GANPTSIISVVIFAIFLGMAALNLMKDDVVKGQRILNAIQTLQAWVMKLVRLVMTLTPYG
VFALMTKVVASSNLADILNLGGFLIASYVGLAIMFAVHAVILLLTGISPVKFFKKVAPVL
TFAFTSRSSAASIPLNIEAQTRRLGVPESIASFSASFGATIGQNGCAGLYPAMLAVMVAP
TLGINTLDPMWIASLVGIVTLSSIGVAGVGGGATFAALIVLPAMGLPVTLVALLISIEPL
IDMGRTALNVNGSMTAGIVTSQLMGQTDKSILNSREEIELAHH