Protein Info for MPMX26_01002 in Acinetobacter radioresistens SK82

Annotation: 5,10-methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02219: MTHFR
  • amino acids 3 to 274 (272 residues), 266.3 bits, E=1.7e-83
• TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]
  • amino acids 7 to 272 (266 residues), 303.1 bits, E=9e-95

Best Hits

Swiss-Prot: 40% identical to METF_PECCC: 5,10-methylenetetrahydrofolate reductase (metF) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 90% identity to aby:ABAYE1141)

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

• folate transformations I (8/13 steps found)

KEGG Metabolic Maps

• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20

Protein Sequence (278 amino acids)

>MPMX26_01002 5,10-methylenetetrahydrofolate reductase (Acinetobacter radioresistens SK82)
MTKRVPISFEFFPPKTDAGAEKLKLVHQDLQYLNPEFFSVTYGAGGSTRERTLAAIEEFN
GKGTPVAPHLSCIGDDKARIAELLDLYKSQNIKRIVALRGDLPSGQVGLGELPYAQDLVR
FIREHSGDHFHIEVAAYPEMHPQAESFDADIRRFIEKVNAGANAGITQFFFNPDSYFYFL
DRLAKEGIHIPIAPGIMPIINASNLIRFADGTGAEIPRWIRKQLSAYGDDSVAIKDFGHE
VVLKLCERLIAGGAPSLHFYSMNQTEPTRQLVLDLGLA