Protein Info for MPMX26_00988 in Acinetobacter radioresistens SK82
Annotation: Chorismate pyruvate-lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to UBIC_ACIBT: Probable chorismate pyruvate-lyase (ubiC) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 74% identity to acd:AOLE_05280)Predicted SEED Role
"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)
MetaCyc Pathways
- 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (8/12 steps found)
- polybrominated phenols biosynthesis (1/4 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (3/9 steps found)
- spongiadioxin C biosynthesis (1/7 steps found)
- polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
- p-HBAD biosynthesis (1/9 steps found)
- superpathway of chorismate metabolism (36/59 steps found)
- tetrahydromethanopterin biosynthesis (3/14 steps found)
- superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
- phenolphthiocerol biosynthesis (1/23 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.3.40
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (170 amino acids)
>MPMX26_00988 Chorismate pyruvate-lyase (Acinetobacter radioresistens SK82) MVNYEVGKVVSSKYKNKHAEQIPAVLKTWLYASGSLTRQLTDLAGGQFRVETLNEYFQRP NFADSQWMKMPAQHTSWVRDTYLYGCETQPWVKAKSIFPILSLQGRARLFQHIGQKPIGH FLFQRTRPACERRVVYLEEGWTRQSCYTWHGCKFIVQETFLPAFEYFIQQ