Protein Info for MPMX26_00986 in Acinetobacter radioresistens SK82

Annotation: 3-hydroxylaminophenol mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR00653: glutamine synthetase, type I" amino acids 4 to 468 (465 residues), 644.6 bits, see alignment E=4.3e-198 PF03951: Gln-synt_N" amino acids 14 to 94 (81 residues), 109.2 bits, see alignment E=6.1e-36 PF00120: Gln-synt_C" amino acids 101 to 466 (366 residues), 440.9 bits, see alignment E=3.2e-136

Best Hits

Swiss-Prot: 72% identical to 3HAPM_CUPNJ: 3-hydroxylaminophenol mutase (Reut_A2057) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 97% identity to abm:ABSDF1172)

MetaCyc: 72% identical to 3-(hydroxyamino)phenol mutase (Cupriavidus pinatubonensis JMP134)
3-(hydroxyamino)phenol mutase. [EC: 5.4.4.3]

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.3 or 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>MPMX26_00986 3-hydroxylaminophenol mutase (Acinetobacter radioresistens SK82)
MANKVLQLIEESGAKWVDFRFTDTKGKEQHVTYPADSIDEDTFEDGKMFDGSSIAGWKGI
EASDMILRPDAETGFIDPFFAEPTVVVTCDVIEPSTGQGYERDPRSIARRAEEYLKSTGI
GDTAFFGPEPEFFVFDEVKWDIDMSGARHTLIAEEAAWSTGKDYEAGNSGHRPRVKGGYF
PVPPVDSSQDMRADMCAKIEDIMGPGRVEVHHHEVASCQLEIGVSFNTMVRKADEVQQFK
YAVWNVAHQYAKTATFMPKPMVGDNGSGMHVHMSISKDGKNLFAGDEYAGLSEMALYFIG
GVIKHARALNAITNPSTNSYKRLVPHFEAPIMLAYSARNRSASIRIPYVSSPKGKRIEAR
FPDPMMNPYLGFAALLMAGLDGIQNKIHPGEAADKNLYDLPPEEEAKIPTVAHSLDMALE
ALKEDHEFLLKGGVFTKDMLDAYIELKTEDVRRLNTTTHPVEFDMYYSL