Protein Info for MPMX26_00953 in Acinetobacter radioresistens SK82

Annotation: FMN reductase (NADH) RutF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01613: Flavin_Reduct
  • amino acids 11 to 160 (150 residues), 131.7 bits, E=1.2e-42

Best Hits

Swiss-Prot: 56% identical to RUTF_PANAM: FMN reductase (NADH) RutF (rutF) from Pantoea ananatis (strain LMG 20103)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 68% identity to abn:AB57_0783)

MetaCyc: 51% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• dibenzothiophene desulfurization (1/5 steps found)
• bacterial bioluminescence (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.1.42

Use Curated BLAST to search for 1.5.1.- or 1.5.1.42

Protein Sequence (167 amino acids)

>MPMX26_00953 FMN reductase (NADH) RutF (Acinetobacter radioresistens SK82)
MVETTDFRNGMSLLTGAVNVITTAGETGRFGFTASAVCSVTDTPPTLLVCMNRSSSSHCH
FKDNGILSVNVLGAHHQQISQAFASRIPMDERFTHGEWTTLLTGSPVLSDALVSFDCRIR
QMNDVGTHTIFYCEVEAIKMNENKESCHGLIYFNRCYHHIGQQEYKL