Protein Info for MPMX26_00952 in Acinetobacter radioresistens SK82

Annotation: Phthalate dioxygenase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00970: FAD_binding_6" amino acids 12 to 97 (86 residues), 22.4 bits, see alignment E=2e-08 PF00111: Fer2" amino acids 237 to 307 (71 residues), 54.3 bits, see alignment E=1.6e-18

Best Hits

KEGG orthology group: K03863, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 82% identity to acd:AOLE_08555)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MPMX26_00952 Phthalate dioxygenase reductase (Acinetobacter radioresistens SK82)
MTALYDVVVKHRYIEGGDIAVMEFESATAQPLPKVEAGAHIDVHLPNGMIRQYSLCQDPA
KKGVFRLGILKDPASRGGSVSAFDDIQNGMQIQVSEPRNLFPLVQAKHTVLIGGGIGITP
LITMAYELLHQGALFELHYCGSSPERCAFVNEIRNGELAAFTRFHFKSEGASHREFFQSA
IKDLDRQSHIYTCGPSGFMDWVINLAQTQNFPEQQIHKEYFQVDTDTSGEAFEVMAQRSG
KIVLVNAEETILQALAREGVEIEMSCEQGVCGTCMCDVIEGEPDHRDVYFTDEEKASNEQ
ILVCCSRSKSARLVLDI