Protein Info for MPMX26_00940 in Acinetobacter radioresistens SK82

Annotation: Sialic acid transporter NanT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 391 (365 residues), 169.1 bits, see alignment E=1.3e-53 PF03137: OATP" amino acids 111 to 336 (226 residues), 40.2 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 77% identity to abc:ACICU_01978)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>MPMX26_00940 Sialic acid transporter NanT (Acinetobacter radioresistens SK82)
MSNLNIQTEGSISKSSVYTWYVVLLCMLAYIFSFIDRQILALMIEPIKADLNLTDTQFSL
LHGLAFSLFYAFMGLPLAYIADRFSRPKLISIGIIFWSLATAFCGLSKNFVQLFLSRMGV
GIGEAALSPAAYSMFSDMFSKEKLGRAVAVYSIGSFVGGGIAFLVGGYVIGLLKDTSLID
VPFFGMLKAWQMAFIIVGLPGIFIGLLFILTVKEPKRKGQRLNAQGEVEKVSFKSSFSFI
GKHRKTFTCHYLGFTFYAMALYCLTSWTPAFYMRKYGMTPTEAGYMLGSVLLVANTLGVF
CAGWLNDWFVKKGRKDAPMITGVIGITGLILPIMFFTQVEPLWLSVTLLVPAMFFASFPM
PISTTAMQMLAPNQLRAQISAIFLLISNLVAVGIGTTLVALITDKIFENPLMVGMSLSIV
GAISCVVAFLLLKFGCKAFAQSMQKEHAA