Protein Info for MPMX26_00910 in Acinetobacter radioresistens SK82

Annotation: Phenol regulator MopR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 PF06505: XylR_N" amino acids 22 to 120 (99 residues), 105.9 bits, see alignment E=3.5e-34 PF02830: V4R" amino acids 134 to 194 (61 residues), 34.1 bits, see alignment E=1.1e-11 PF00158: Sigma54_activat" amino acids 246 to 411 (166 residues), 227.2 bits, see alignment E=4.5e-71 PF14532: Sigma54_activ_2" amino acids 246 to 416 (171 residues), 65.6 bits, see alignment E=2.7e-21 PF07728: AAA_5" amino acids 269 to 388 (120 residues), 27.1 bits, see alignment E=1.7e-09 PF00004: AAA" amino acids 269 to 401 (133 residues), 21.2 bits, see alignment E=1.5e-07 PF01078: Mg_chelatase" amino acids 324 to 386 (63 residues), 20.5 bits, see alignment E=1.2e-07 PF25601: AAA_lid_14" amino acids 417 to 498 (82 residues), 93.5 bits, see alignment E=2.6e-30 PF02954: HTH_8" amino acids 514 to 553 (40 residues), 46 bits, see alignment 1.5e-15

Best Hits

Swiss-Prot: 81% identical to MOPR_ACIGI: Phenol regulator MopR (mopR) from Acinetobacter guillouiae

KEGG orthology group: None (inferred from 73% identity to acd:AOLE_13290)

Predicted SEED Role

"Positive regulator of phenol hydroxylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>MPMX26_00910 Phenol regulator MopR (Acinetobacter radioresistens SK82)
MPQAKDANFYTQILEKNKDIQDLLDKIQFDSQHGKIWFEENRMLLMHTSIMGFLRKDLYN
MLGWERTKRFFIRLGYQAGVRDAEVTSKLRPNLNEAEAFMAGPQMHGIRGMVQVEVNELQ
LSHDEHQFYADFNWRNSFEAEVHLSEFGASEESVCWMLLGYACGYTSFVMGQTIIYQETH
CVAKGDDCCRIIGKPLKEWENADELIQFMSPDPVSDELIALQAELNELKKNIYTDVEADY
TMFNSIGESVAYRKVCDLLKKAAGSKVAVLLQGETGVGKEAFARGIHEGSSRKGQPFIAV
NCACIPPDLIEAELFGVEKGAFTGATQTRSGKFERADQGTIFLDEVIELSSRAQAALLRM
LQEGEYERVGDHQTRKADVRLVAATNEDLEQAVKEGRFRADLYYRLNIFPVIIPPLRERR
DDIPLLITHFLSRFENMYGKTLKGLSDKAKNFVMTYEWPGNIRELENLLERATLLTDHQE
EIKLHHLFPQIKQDIEPRSEKVDLEAVIQEGFCLEDHEKKLIFIAMQKTNNNISEAARVL
GISRPALDYRLKKQAINIGKK