Protein Info for MPMX26_00904 in Acinetobacter radioresistens SK82

Annotation: Phenol hydroxylase P5 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00111: Fer2" amino acids 5 to 82 (78 residues), 72.7 bits, see alignment E=3.8e-24 PF00970: FAD_binding_6" amino acids 107 to 198 (92 residues), 53.8 bits, see alignment E=4.4e-18 PF00175: NAD_binding_1" amino acids 210 to 315 (106 residues), 64 bits, see alignment E=3.9e-21

Best Hits

Swiss-Prot: 87% identical to DMPP_ACICP: Phenol hydroxylase P5 protein (mphP) from Acinetobacter calcoaceticus (strain PHEA-2)

KEGG orthology group: None (inferred from 87% identity to acd:AOLE_13320)

MetaCyc: 88% identical to DMSO monooxygenase reductase component (Acinetobacter sp. strain 20B)
RXN-20073 [EC: 1.14.13.245]; 1.14.13.245 [EC: 1.14.13.245]

Predicted SEED Role

"Phenol hydroxylase, FAD- and [2Fe-2S]-containing reductase component DmpP"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.245

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>MPMX26_00904 Phenol hydroxylase P5 protein (Acinetobacter radioresistens SK82)
MSYQVTIEPVGMTIEVEEDQTILDAALRQGVWLPFACGHGTCGTCKVQVTDGFYDVGEAS
PFALMDIEREENKVLACCCKPESDMVIEADVDEDEDFLGYLVQDYQAKVLEIKQLSPTIK
GVRLQIDRPMEFQAGQYINLQLPNIEGTRAFSIANPPSEEGIIELHIRQVLGGTATTYVH
ETLQAGDELQVSGPYGQFFVRKSDEKDAIFIAGGSGLSSPQSMILDLLEQGDTRTIYLFQ
GARDVSELYNREVFETLVKDYPNFRYIPALNAPKTEDQWTGFTGFVHEAVADYFENKCSG
HKAYLCGPPPMIDAAISTLMQSRLFEKDIHTERFLSAADGASNQARSALFRHI