Protein Info for MPMX26_00809 in Acinetobacter radioresistens SK82

Annotation: Membrane-bound lytic murein transglycosylase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01464: SLT
  • amino acids 92 to 198 (107 residues), 110 bits, E=2.5e-36

Best Hits

KEGG orthology group: None (inferred from 50% identity to pcr:Pcryo_0393)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (283 amino acids)

>MPMX26_00809 Membrane-bound lytic murein transglycosylase F (Acinetobacter radioresistens SK82)
MKTYFDISRLGIWGCAVLVLTSSYSSAGQMYVYKDQSGSTLLTNRKMNDSSLKKVKVTYY
PESNIHSYSNWGKSEAAVLPSYSKNRDAFDHIIKQAAQQHGVSEGLIKAVMHTESGFNVN
ARSPVGAQGLMQLMPATARRFNVSNAYDPYQNILGGAKYLSWLLKRFKGNTHLALAAYNA
GEGNVAKYGGIPPFRETQDYVRRVTSRYSNLYSGGALNLTASNNPENGLLVQETVNSAAN
TQAAGRSYAPRQIITLADGSYTDAPGTYVSSNATASARIHISN