Protein Info for MPMX26_00765 in Acinetobacter radioresistens SK82

Annotation: Transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01462: transcription elongation factor GreA
  • amino acids 5 to 156 (152 residues), 196.5 bits, E=1.3e-62
• PF03449: GreA_GreB_N
  • amino acids 5 to 74 (70 residues), 108.7 bits, E=1.4e-35
• PF01272: GreA_GreB
  • amino acids 82 to 157 (76 residues), 100.1 bits, E=5.5e-33

Best Hits

Swiss-Prot: 90% identical to GREA_ACIBS: Transcription elongation factor GreA (greA) from Acinetobacter baumannii (strain SDF)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 93% identity to aci:ACIAD2862)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Protein Sequence (158 amino acids)

>MPMX26_00765 Transcription elongation factor GreA (Acinetobacter radioresistens SK82)
MQRYPMTPEGKTALEKELHQLKTVERPRITAAIAEAREHGDLKENAEYHAAREQQGFCEG
RIQDIEGKLGAAQVIDIKDLEQNGRVVFGVTVTIENLDTEEQKTYKIVGDDEADFKINKI
SVNSPIARGLLGKSEGDEAKIVTPQGEVEYEIVSVEYI