Protein Info for MPMX26_00752 in Acinetobacter radioresistens SK82

Annotation: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 75 (72 residues), 60.8 bits, E=1.4e-20
• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 4 to 406 (403 residues), 592.5 bits, E=2.5e-182
• PF02817: E3_binding
  • amino acids 123 to 153 (31 residues), 44 bits, see alignment (E = 3.1e-15)
• PF00198: 2-oxoacid_dh
  • amino acids 177 to 404 (228 residues), 282.4 bits, E=3.9e-88

Best Hits

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 91% identity to aci:ACIAD2875)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Protein Sequence (407 amino acids)

>MPMX26_00752 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (Acinetobacter radioresistens SK82)
MATEIKAPVFPESVADGTIATWHKKVGEAVSRDEVICDIETDKVVLEVVAPADGALVAIV
KDEGDTVLSDEVIAQFEAGAGATAEPAQTAVTSDGNVENASANTEAGPAPVVERSQPVQD
QAPAVRKALTETGINASDVSGTGRGGRITKEDVANHQSKPAAAAQPQALSVAVGERIEKR
VPMTRLRKRVAERLLAATQETAMLTTFNEVNMKPIMDMRNQYKDAFEKRHGARLGFMSFF
VKAATEALKRYPAVNASIDGDDIVYHGFYDIGVAVSSDRGLVVPVLRDTDRMNYAEVENG
IRAYAGKAREGKLAIEDMTGGTFTITNGGTFGSLLSTPILNTPQTAILGMHKIQERPMAV
NGQVEILPMMYLALSYDHRLIDGKEAVGFLVTIKELLEEPAKLILDL