Protein Info for MPMX26_00676 in Acinetobacter radioresistens SK82

Annotation: Glutamate/aspartate import permease protein GltK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 120 (105 residues), 75.9 bits, see alignment E=1.5e-25 PF00528: BPD_transp_1" amino acids 36 to 225 (190 residues), 66.6 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 54% identical to GLTK_ECOLI: Glutamate/aspartate import permease protein GltK (gltK) from Escherichia coli (strain K12)

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 63% identity to prw:PsycPRwf_0680)

MetaCyc: 54% identical to glutamate/aspartate ABC transporter membrane subunit GltK (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>MPMX26_00676 Glutamate/aspartate import permease protein GltK (Acinetobacter radioresistens SK82)
MEWLTSFLQDLQASGPALWYGMTITLKVVCIATLGGILIGTLLALMRLSSFRILNLVAQA
YVNLFRSIPLLLVLMWFYFAVPFIYTTITGRFLTIDTALVSSIVAFMLFEAAYFSEIVRA
GIQSIPRGQSAAAYALGMTYSQNMRLVVLPQAFRKMTPLLLQQTIILFQDSTMVYAIGLL
DFFRSNYVRGDLMSLLTQYILFAGLVYFTISALATYTVRRLQKRLHV