Protein Info for MPMX26_00673 in Acinetobacter radioresistens SK82

Annotation: Phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00702: Hydrolase" amino acids 2 to 196 (195 residues), 109.4 bits, see alignment E=7.9e-35 PF12710: HAD" amino acids 5 to 192 (188 residues), 30.5 bits, see alignment E=1.2e-10 PF13419: HAD_2" amino acids 5 to 201 (197 residues), 108.3 bits, see alignment E=1.3e-34 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 99 to 202 (104 residues), 55.4 bits, see alignment E=1.6e-18 TIGR01662: HAD hydrolase, family IIIA" amino acids 104 to 203 (100 residues), 53.6 bits, see alignment E=5.3e-18 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 106 to 196 (91 residues), 60.4 bits, see alignment E=5.5e-20 PF13242: Hydrolase_like" amino acids 158 to 202 (45 residues), 44 bits, see alignment 4.2e-15

Best Hits

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MPMX26_00673 Phosphoglycolate phosphatase (Acinetobacter radioresistens SK82)
MIQAILFDLDNTLTHRDQSVEAYSYYLAQYYQRHLGEVDVMQIKAIINRIDNGGYPKKEL
LTHPSIAASVAQALQHELKWHHAVDFDELTAFWFEQFGLHAVPMEGSEQVLQELKQQGFK
LAIVSNGGHDTRLKIIEGLNIAHYFDLIVSSELAGSKKPEPEIFQYVCQRLNVMPEECLF
IGDHPINDIQGAQNAGMHPVWMEGFHEVDPYDAQLISPRIKKLEEIWQFIG