Protein Info for MPMX26_00658 in Acinetobacter radioresistens SK82

Annotation: Aromatic amino acid transport protein AroP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 416 to 438 (23 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details PF00324: AA_permease" amino acids 32 to 436 (405 residues), 405.7 bits, see alignment E=2.5e-125 PF13520: AA_permease_2" amino acids 36 to 447 (412 residues), 130.4 bits, see alignment E=9e-42

Best Hits

Swiss-Prot: 62% identical to AROP_ECOL6: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 87% identity to aci:ACIAD2969)

MetaCyc: 62% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>MPMX26_00658 Aromatic amino acid transport protein AroP (Acinetobacter radioresistens SK82)
MQYITILDLVIVELSTLNNNTSQLQRGLKNRHIQLIAMGGAIGTGLFLGSAQVIQSAGPS
IILGYAIGGLIAFLIMRQLGEMIVHEPVAGSFSHFAHKYWGNFPGFLAGWNYWILYILVA
MTELTAVAKYINYWWPHIPAWASVLFFFVIITLVNLGNVKFYGESEFWLSIIKVAAVISM
IVFGLYLIFTADASSGASFSNLWSHGGFFPNGFDGLFYMLAFLMFAFGGIELIGMAAAEA
ENPEKTIPKAINQVVFRILLFYVGSLTILLSLVPWNQLELGGLDKSPFVMIFSQLGIGWA
AHLLNFIILTAALSVYNSGMYANSRMLYGLAQQGNAPKIFLKVNKQGVPIPAVLFSALLI
FGCVLLNYLIPEDALGHLMYVVVGALVLNWAMITLTHLKFKDYIQKNGILSKFPALFSPL
SNYIVLVFIAVVLYIMWTQGFKESVLMLPIWVVLMLVLYKILKPRV