Protein Info for MPMX26_00650 in Acinetobacter radioresistens SK82

Annotation: Phosphoserine phosphatase ThrH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02137: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
  • amino acids 1 to 199 (199 residues), 320.6 bits, E=3.6e-100
• TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB
  • amino acids 4 to 160 (157 residues), 48.6 bits, E=9.3e-17
• PF00702: Hydrolase
  • amino acids 42 to 164 (123 residues), 45.2 bits, E=1.5e-15
• PF12710: HAD
  • amino acids 60 to 160 (101 residues), 32.5 bits, E=1.2e-11

Best Hits

Swiss-Prot: 65% identical to THRH_PSESM: Phosphoserine phosphatase (PSPTO_2281) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02203, phosphoserine / homoserine phosphotransferase [EC: 2.7.1.39 3.1.3.3] (inferred from 96% identity to aci:ACIAD0834)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39, 3.1.3.3

Use Curated BLAST to search for 2.7.1.39 or 3.1.3.3

Protein Sequence (205 amino acids)

>MPMX26_00650 Phosphoserine phosphatase ThrH (Acinetobacter radioresistens SK82)
MEIVCLDLEGVLVPEIWINFAKKTGIKELEATTRDIPDYDVLMTQRLNILKQHGLGLNDI
QAVIADMGPLPGAKEFVEWVRTHFQLIILSDTFYEFAHPLMQQLGWPTIFCHKLETDEKG
MITAYKLRQPDQKREAVKALHNLNFRVIAAGDSYNDTTMLGEADHGFLFDAPENVIAEFP
QFQAIHGYAALKEAIRSVSLRDIPA