Protein Info for MPMX26_00649 in Acinetobacter radioresistens SK82

Annotation: Phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF01507: PAPS_reduct" amino acids 36 to 212 (177 residues), 171.6 bits, see alignment E=8.2e-55 TIGR02055: adenylylsulfate reductase, thioredoxin dependent" amino acids 42 to 237 (196 residues), 257 bits, see alignment E=5.6e-81

Best Hits

Swiss-Prot: 66% identical to CYSH_PSEAE: Phosphoadenosine phosphosulfate reductase (cysH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 89% identity to abc:ACICU_03025)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>MPMX26_00649 Phosphoadenosine phosphosulfate reductase (Acinetobacter radioresistens SK82)
MTAIPTIDIVDALASEYADKSPSEILELALSQEGEIAISFSGAEDVVLIDMASRLGKPFR
VFSLDTGRLHSETYQFIEKVRNHYNIEIEICFPEAEPLLDMVNRKGLFSFYVDGHQECCG
IRKVQPLRKKLATLDGWITGQRRDQSPGTRTEIPVVQADTGFSGPGKQLIKYNPLANWSS
SDVWSYIRLMEIPYNALHERGFISIGCEPCTKAVLPNQHEREGRWWWEEATHKECGLHAG
NLKK