Protein Info for MPMX26_00645 in Acinetobacter radioresistens SK82

Annotation: dTTP/UTP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00172: septum formation protein Maf" amino acids 14 to 193 (180 residues), 174.4 bits, see alignment E=9e-56 PF02545: Maf" amino acids 14 to 194 (181 residues), 207.9 bits, see alignment E=5.6e-66

Best Hits

Swiss-Prot: 75% identical to NTPPA_ACIAD: dTTP/UTP pyrophosphatase (ACIAD0829) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K06287, septum formation protein (inferred from 76% identity to aby:ABAYE0704)

MetaCyc: 46% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>MPMX26_00645 dTTP/UTP pyrophosphatase (Acinetobacter radioresistens SK82)
MLAHPLLPAAKMAHLILASSSPRRQELLRQLGLEFDIHSPDIDESTRAGESVPEYVERLA
RQKAQAVLAQYPESVIIAADTSLGLDGTIIGKPESKQHAFEIWSKLSGRHHDVFSGVCIA
TSRQISSIVVHTQVEFQTLSPNDMEHYWATGEPEGKAGAYAIQGIAAQYIPRIFGSYTNV
VGLPLHETIQLLKAVKALN