Protein Info for MPMX26_00644 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 43 to 68 (26 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details TIGR03426: rod shape-determining protein MreD" amino acids 14 to 159 (146 residues), 73.7 bits, see alignment E=8e-25 PF04093: MreD" amino acids 16 to 160 (145 residues), 51.8 bits, see alignment E=5.3e-18

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 76% identity to aby:ABAYE0703)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>MPMX26_00644 hypothetical protein (Acinetobacter radioresistens SK82)
MPIAKLRYEKRKDPLIVIILSVIVGSVLMVYPLSYDISGWRPLFMLMIMLFWILCQPSWT
GVWFAFAVGIFTDLLRDAPLGMNALSFVLITFVVRWFTRERRILTFGNLWVLTTLAIFAH
LLFTWFTQVMAGLHFSIARHWQPLLSSILCWPILYYLLRKWRI