Protein Info for MPMX26_00641 in Acinetobacter radioresistens SK82

Annotation: Glutamyl-tRNA(Gln) amidotransferase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 TIGR00135: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit" amino acids 13 to 104 (92 residues), 93.4 bits, see alignment E=4.1e-31 PF02686: GatC" amino acids 28 to 99 (72 residues), 66.9 bits, see alignment E=7.3e-23

Best Hits

Swiss-Prot: 55% identical to GATC_AZOVD: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (gatC) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K02435, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C [EC: 6.3.5.6 6.3.5.7] (inferred from 90% identity to abm:ABSDF0679)

Predicted SEED Role

"Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)" (EC 6.3.5.6, EC 6.3.5.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.6, 6.3.5.7

Use Curated BLAST to search for 6.3.5.6 or 6.3.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>MPMX26_00641 Glutamyl-tRNA(Gln) amidotransferase subunit C (Acinetobacter radioresistens SK82)
MSTPDAQHSADLNAQTVSAIANLARLSLNDTQSAEYAQSLNKILGMMDTLKAIDTEGVEP
LKSPFDHPQPLRQDVVTETNHREEYQAVAPATEAGLYLVPRVIE