Protein Info for MPMX26_00637 in Acinetobacter radioresistens SK82

Annotation: Aromatic amino acid exporter YddG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details PF00892: EamA" amino acids 159 to 289 (131 residues), 53.7 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: None (inferred from 57% identity to acd:AOLE_12425)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MPMX26_00637 Aromatic amino acid exporter YddG (Acinetobacter radioresistens SK82)
MSKNLATLIGFSAILQWSSIVGLLKKVSANIGADLAVLFMYSLSAVLLFALFRIPNLKII
PRKYLFGATALFVVYEICFSYAIALAQNAQQAIEISLVNYLWPSMTILMLILFKELNFNK
WVILGLGISLAGVFYIQTGNGTIDLAAVISHMQSNPLSYGLAFVGASLWSLYCVMTKKYS
QGHNPISLFFIATSLVLWLKMLVLHPEQFVHIVQIDATTLMYMLMVSTVTGLGYAAWNIG
INRGNITMLVTLSYFSPIFSSIMSMWILQTPLSKTFWLGAIMVTLGSFVCWISTNWHELK
QRFITMRLRQT