Protein Info for MPMX26_00623 in Acinetobacter radioresistens SK82

Annotation: Amino-acid carrier protein AlsT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 322 to 346 (25 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 21 to 461 (441 residues), 512.5 bits, see alignment E=4.4e-158 PF01235: Na_Ala_symp" amino acids 59 to 474 (416 residues), 531.1 bits, see alignment E=1.1e-163

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 78% identity to aci:ACIAD0805)

Predicted SEED Role

"sodium/alanine symporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>MPMX26_00623 Amino-acid carrier protein AlsT (Acinetobacter radioresistens SK82)
MDEQLNTRLMAWVSFFNDPLWDFLVVFLVVVGVFYTLLTGAVQIRLFLHSIRVMKGSRKE
GDDQHGITPFQAFVTGLASRVGVGNVAGVAIAIAIGGPGAVFWMWFTAFLGMSSAFVESS
LAQLFKVRDHQNQQFRGGPAYYITQGLKQKWLGVVFALSLILAYGFVFNAVQANSIVDAT
AHAWGWDRANIMLDLGGLGFEVSWVGVVLVIMTAAIIFGGIKRIAVVAERMVPLMAVLYL
AVALYIAIINFSILPDIFKLIFTEAFKFDAAAGGFFGAMVSMAMMQGIKRGLFSNEAGMG
SAPNAAAASDVKHPVDQGLVQMLGVFVDTFVVCSCTAIIILASGLYHEAGFEGVTLTQMA
LVSQIGSWGDDFLALILFLFAYSSIIGNYAYAESNVQFINNQPKVMFVFRLLVLAMVYFG
AITSVPLVWSMADLSMGLMATINLFAILLLTPFLRMLLKDYSSQLKKGIKEPEFKIDKYP
ELKKKVDSDIW