Protein Info for MPMX26_00619 in Acinetobacter radioresistens SK82

Annotation: Bicyclomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 17 to 394 (378 residues), 290.9 bits, see alignment E=1e-90 PF07690: MFS_1" amino acids 21 to 363 (343 residues), 172.3 bits, see alignment E=1.4e-54 PF00083: Sugar_tr" amino acids 48 to 209 (162 residues), 38.7 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 68% identity to aci:ACIAD0802)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>MPMX26_00619 Bicyclomycin resistance protein (Acinetobacter radioresistens SK82)
MDLSKDNSRSHYSLPWLMLLASLTALGPLSIDMYLPALPGMAEEFGVSTQMVANTLPAYF
LGLAVGQLIYGPVSDRIGRKKPLYFGLLLYVVASLLCAFATSEWSLIFSRILQALGGCVG
VVIARAAIRDRLDVQASAQAFASMMIVMGIAPVMAPALGAWLLIYFEWHAIFVALALIGI
ICCICVALFFKETLQPERRLKLSARQVLSLYKTIFQDKSFRGPMVIGCFTGAVLFCYISS
AASVLIDQYHLSQQHFAYAFGFNAVGITLFSSINKRLARNMSIIQRLKLGGILQLMGVFI
LLGAGLYDDTALAIVMSGLFLAVSGIGFTGPNAMALAMAEQGSRAGTASAIMGSMQFACG
LVGGLILNFLFWSPLLNMALVMLFFIVIGVASIFKTRNSLAL