Protein Info for MPMX26_00618 in Acinetobacter radioresistens SK82

Annotation: Inner membrane protein YccS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 418 to 435 (18 residues), see Phobius details amino acids 443 to 462 (20 residues), see Phobius details amino acids 466 to 481 (16 residues), see Phobius details amino acids 488 to 505 (18 residues), see Phobius details amino acids 517 to 536 (20 residues), see Phobius details amino acids 611 to 628 (18 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 12 to 707 (696 residues), 785.9 bits, see alignment E=3.2e-240 TIGR01666: TIGR01666 family membrane protein" amino acids 12 to 707 (696 residues), 841.8 bits, see alignment E=3.8e-257 PF12805: FUSC-like" amino acids 68 to 349 (282 residues), 305.6 bits, see alignment E=2.9e-95 PF13515: FUSC_2" amino acids 408 to 529 (122 residues), 92 bits, see alignment E=3.4e-30

Best Hits

KEGG orthology group: None (inferred from 81% identity to aci:ACIAD0801)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (723 amino acids)

>MPMX26_00618 Inner membrane protein YccS (Acinetobacter radioresistens SK82)
MKAWLTRVQQATYNTSFMYNVRMIIAFTATAFVPYLLGQQLATIPLTLGVVAAALSDIDD
RFSVRIMNLVYTYIGFFITAASIQFLFPYPVLFAIGLIISCIGWILLGSLGRRYATISYG
CLVISVYSMLGVHLFDHWYNQPLLLVAGAVWYGVISTISFLLFPVRQVQDKLSQCYSALG
DFLFAKSALFDVDMTSDSYQQSMIDLSLENGKLVGIFNEMKTALLTRLKGDRGQRDTRRS
LHYYFAAQDIHERVDSAHIDYQKLAKIFEHSDILFRFQRILTIQGKACKDLGESILKRTT
YQHNRRFKHAFENLRISLEKLRDEQYYDQVWVNALFALYRNLKSIDAQLRNVETERYVVE
RSRYLENQLKDDDLKGWDDIVIRIKQHLTPESVLFRHAVRLSIVLFIGYVFVQLTNIQYG
YWILLTALFVSQPNFNATKRRLRLRIVGTLVGIIIGYAILYFVPSIEGQLCLLVLSGVLF
FELRSKQYAQATAFITILALINFNLDGMGFTAALPRMIDTLIGCALAWFGVSFIWPDWKF
RRLPRSIQRALSAQCDYLNEVVQQYHEGRNNGLTYRIVRRSAHNTDAEMASLISTLATEP
DFDPLQKSRAFEFLCLSHTFLSYIAALGAHREQVKDQEILKLLDQALDDIRGALLRDETP
DLSAQNILIATRERLRQNHEEDQKSLIILQQLSLMLSILQQLSTLKQSLSNEQDNAATEL
ASL