Protein Info for MPMX26_00572 in Acinetobacter radioresistens SK82

Annotation: Pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 9 to 100 (92 residues), 73.8 bits, E=1.4e-24
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 9 to 267 (259 residues), 253.1 bits, E=1.8e-79
• PF14748: P5CR_dimer
  • amino acids 163 to 267 (105 residues), 122.7 bits, E=7.6e-40

Best Hits

Swiss-Prot: 48% identical to P5CR_HAEIN: Pyrroline-5-carboxylate reductase (proC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 81% identity to aby:ABAYE3151)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (2/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• L-arginine degradation VI (arginase 2 pathway) (2/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Protein Sequence (276 amino acids)

>MPMX26_00572 Pyrroline-5-carboxylate reductase (Acinetobacter radioresistens SK82)
MSTALNCNICFIGGGNMAQALIGGLLARGLPATRITVADPVEQIRSLLQEKDIHVTEDNI
AAIHDANVVVLAVKPQVLAKVLQPLKGLFAGKLLISIVAGAQIATIAELVESDQVVRVMP
NTPALVQTGAHGLYASPAVQQADRDLASQILASTGLTLWVNTEEQIDAVTAVSGSGPAYF
FYMMESMIQAGKNLGLDEKVATALTLQTALGAAQMAITSSSSPSELRKNVTSPNGTTQAA
LEMFDRAQISQNIQAALAAAKKRSQELAQELSESTK