Protein Info for MPMX26_00552 in Acinetobacter radioresistens SK82

Annotation: Long-chain-fatty-acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 PF00501: AMP-binding" amino acids 24 to 404 (381 residues), 282.4 bits, see alignment E=5.3e-88 PF13193: AMP-binding_C" amino acids 454 to 528 (75 residues), 74.3 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 85% identity to aci:ACIAD3056)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>MPMX26_00552 Long-chain-fatty-acid--CoA ligase (Acinetobacter radioresistens SK82)
MVSAYDELPRTPANFVALSPLRYLERAAYIYPHQAAIIHGSRQISWRETYQRCRQFADQL
QKLGIQKNDTVSVLLPNVPAMIEAHFAVPMAGAVLNTLNTRLDAKTLAFMLEHAESKVLL
VDPEFSTLAKEALALVSQDIYVIDVDDAEYENCFNAPIGEIEYEDWLTEGNADFEWHLPQ
DEWDAISLNYTSGTTGNPKGVVYHHRGAYINAASNIIACGMTPRATYLWTLPLFHCNGWC
FAWTMAANGGTNVCLRKVDPELIFKLIAEHKVDYFCGAPIVLSMLINTPAEKRTYFDHRV
EVMVAGAAPPAAIIEGMRNIGINVTHVYGLTETYGPSALCASQAGWSDLTIQEQAQLHSR
QGVPYPLQDGMKVLDPETMLPVPNDGQSMGEIMFRGNIVMKGYLKNPEATAEAFKGGWFH
TGDLAVCQPDGYAKITDRAKDVIISGGENISSLEVEEVLYQHPAVLTAAVVAKPDPRWQE
VPCAFVELKEGISISAEELTEHCKQGLARFKVPKEIIITDIPKTSTGKLQKFILREWAKE
RSVGEFG