Protein Info for MPMX26_00538 in Acinetobacter radioresistens SK82

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 18 to 65 (48 residues), 24.2 bits, 1.1e-08
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 42 to 450 (409 residues), 323.2 bits, E=1.3e-100
• PF05958: tRNA_U5-meth_tr
  • amino acids 108 to 457 (350 residues), 100.8 bits, E=3.7e-32
• PF01135: PCMT
  • amino acids 282 to 373 (92 residues), 40.5 bits, E=1.2e-13
• PF01209: Ubie_methyltran
  • amino acids 304 to 366 (63 residues), 28 bits, E=6e-10
• PF05175: MTS
  • amino acids 305 to 391 (87 residues), 24 bits, E=1.2e-08
• PF13847: Methyltransf_31
  • amino acids 308 to 405 (98 residues), 58.5 bits, E=3.1e-19
• PF13649: Methyltransf_25
  • amino acids 313 to 386 (74 residues), 36.8 bits, E=2.4e-12

Best Hits

Swiss-Prot: 68% identical to RLMD_ACIBY: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Acinetobacter baumannii (strain AYE)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 68% identity to aby:ABAYE3182)

Predicted SEED Role

"RNA methyltransferase, TrmA family"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (463 amino acids)

>MPMX26_00538 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Acinetobacter radioresistens SK82)
MRHKAKPRSAQPAHYVFKVEVFSHEGRGIAHYGNEPGHPVEKQGKKVFITGALPGETVQA
RITHHTKRLEEADSVQLLSEPSSYRIEPVCPHFGLCGGCSLQHMHPDEQIRFKQDVLASH
LKHFAAIEPEEWLPALRSTREDYRRKARIGVRFLAKEQKLKFGFRERQTNHLVSIQTCKV
LDRAMAGHLNELQLLLESLTAKAAIGHIELAMGDHDIALVIRNIEKLPQVDVNQLTQYAL
SRQWQLYLQPAGPESLYRVDQPDASKYLHYRLEEFDIDFAFSPLDFTQVNSTVNSQMVSL
ACNLLNLQPGERVLDLFCGLGNFSLPLARCVGETGQVIAVEGSEDMVKRGTENARSNKLL
NVRFYSQDLTKDFSSHSWAKQGFDALLIDPPRAGAEEVMHYLPNFNAKRIVYVSCNPATL
ARDAGILVEHGYRLKKAGVMDMFTHTGHVESIVLFEKINKIND