Protein Info for MPMX26_00528 in Acinetobacter radioresistens SK82

Annotation: NAD(P) transhydrogenase subunit alpha part 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF05222: AlaDh_PNT_N" amino acids 4 to 136 (133 residues), 130.2 bits, see alignment E=9.4e-42 PF01262: AlaDh_PNT_C" amino acids 140 to 371 (232 residues), 222.8 bits, see alignment E=5.3e-70

Best Hits

Swiss-Prot: 40% identical to PNTAA_RICPR: NAD(P) transhydrogenase subunit alpha part 1 (pntAA) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 92% identity to acd:AOLE_16625)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>MPMX26_00528 NAD(P) transhydrogenase subunit alpha part 1 (Acinetobacter radioresistens SK82)
MQIGIPTETVIGENRVAATPETVKKLINAGHSVVIERGAGVKAAYIDSAYEQVGATITDD
AYQNSQIILKVRAPKGEEIQKLSPHTTVVAMFDPYRNTELDQFASQQVSAFALELLPRTL
SRAQNMDVLSSQANLAGYKSVLLAANEYQRMFPMLMTAAGTVKPARVVVMGVGVAGLQAI
ATAKRLGAVVEATDLRPTAKDQVESLGGKWLDVPMSAEEQQRAAEAAKNGYGWMPGEQYI
KDQAAIVDKAVSNADIVITTALLPGRDAPRLIKAETVAKMKPGSVILDMAVESGGNVEGS
KCGETVTTSNGVKILGVPNIPATVATEASALYARNVFNFVETMFDQEKNFTVNLEDEIQK
ALLVTHNGQVLLKRG