Protein Info for MPMX26_00527 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 139 to 155 (17 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details PF00892: EamA" amino acids 17 to 154 (138 residues), 60.4 bits, see alignment E=1.2e-20 amino acids 168 to 306 (139 residues), 56.2 bits, see alignment E=2.4e-19

Best Hits

KEGG orthology group: None (inferred from 75% identity to abn:AB57_0669)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>MPMX26_00527 hypothetical protein (Acinetobacter radioresistens SK82)
MIKQDYKMKFSITRIQLGSLFAICSAFLFSTKAIFIKQTYALSPLVDATLLMALRMASAL
PFFLVICWLNRHRNQDIRPREWLLLVLAGILGYYLASWLDFLGLMFISASLERIILFLYP
TLTVLASSLIYRQKLAPKMLFAILLSYSGTVLVMLQEHQSGPENSLWLGAGLVFASAVAF
SAYLLLTPHLIHKFGSWNFTGLALSVACSGTLIHYFLATPQPLVLITQLPASVIWYGIAL
GILVTVLPTILLMQSIERLGAAQSAMIASIGPILTLLLAVVFLDEYLNGWQWLGCILNIV
GVMIITLSKRKLQH