Protein Info for MPMX26_00475 in Acinetobacter radioresistens SK82

Annotation: putative signaling protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 137 to 162 (26 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details PF03707: MHYT" amino acids 53 to 110 (58 residues), 55.8 bits, see alignment 5.7e-19 amino acids 116 to 167 (52 residues), 46.9 bits, see alignment 3.4e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 258 to 421 (164 residues), 134.5 bits, see alignment E=1.5e-43 PF00990: GGDEF" amino acids 262 to 417 (156 residues), 141.8 bits, see alignment E=2.6e-45 PF00563: EAL" amino acids 440 to 674 (235 residues), 232.1 bits, see alignment E=9.1e-73

Best Hits

KEGG orthology group: None (inferred from 63% identity to aci:ACIAD3099)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (689 amino acids)

>MPMX26_00475 putative signaling protein (Acinetobacter radioresistens SK82)
MVHMHYNSILVLGSVLVAVAVCYIAISLREFLIQNTFPKYHNVVLAGSGLFLGLAICSMH
FAGLLAVHLSQESVFDPALTIVSYLVASAASIFALWLTSREFLSLPRLVLAAVVMGLGIS
GMHYTGMMGLILHGYMIYYQLLLVILSVLVGILGTGLSFWLAFKYQHATKYRFWIKLGVA
LVFALSISSVHYIAMAGVVFYTGGQIEVLEHYQAGRTLLLFTIVFITCLVLMTAFLVAIL
EERLEERNRRLMEINKELANLAVQDNLTRLPNRLFLLDYAQYLFIEHKINKKSFAFLYID
LDRFKAVNDAFGHQVGDQLLIQVAARIHQNLGPEAKLLRVGGDEFLLIIENTGRKRAIYY
AEKVLSLIQASYLIAGKEINISCSIGIAIYPEHGTNLQDLLINADAAMLASKEQGRNTYA
VFSYSVHQYEAQSQSKLINDMYKAVEERQFILFYQPKFSAKTYEVCGVEALIRWKHPTLG
LLSPNMFIEGAEKTGLIIPMGYWALEEACKQIQYWEQNGISLCPVAVNLSAIQFEHQKLF
DTLENLLEKYRIQPNNLIIEITESTAMHHIELSIRSFERLRKMGIRLAIDDFGTGHSSLL
YLKDLPVDELKIDRGFIVGLKPGNKEEIILESIIQLATKLGLIVTAEGVETPLQAEILTR
LGCQQLQGYLLGAPVEVERLKVYKQSVQL