Protein Info for MPMX26_00422 in Acinetobacter radioresistens SK82

Annotation: GDP-mannose-dependent alpha-mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 57 to 224 (168 residues), 90.5 bits, E=3.8e-29
• PF13579: Glyco_trans_4_4
  • amino acids 59 to 210 (152 residues), 47.7 bits, E=6.8e-16
• PF13477: Glyco_trans_4_2
  • amino acids 64 to 169 (106 residues), 23.6 bits, E=1.6e-08
• PF20706: GT4-conflict
  • amino acids 226 to 347 (122 residues), 26.2 bits, E=1.2e-09
• PF00534: Glycos_transf_1
  • amino acids 233 to 396 (164 residues), 123.7 bits, E=1.8e-39
• PF13692: Glyco_trans_1_4
  • amino acids 246 to 382 (137 residues), 104.9 bits, E=1.3e-33

Best Hits

KEGG orthology group: K00754, [EC: 2.4.1.-] (inferred from 67% identity to aby:ABAYE3270)

Predicted SEED Role

"Glycosyltransferase"

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (425 amino acids)

>MPMX26_00422 GDP-mannose-dependent alpha-mannosyltransferase (Acinetobacter radioresistens SK82)
MSNPYATAFKQQDFPENFRFYFKNQQLNSTSEVELIQGIVRPRLKIALVTETWPPEINGV
ALSLLQLCKGLQQQGHKILLIRPHQHQPCPHFTPNRECLVVSQAIPRYPGLHFGWPQYLK
VSQALDDFKPHVVHIVTEGPLGLTALQAAKSAGIPVSSGFHSPFQDFSRFFDLAFLVKPV
QKYLCWFHNSTQLTCIPSKDTEQLLKDMGVSCPLKVIARGVDPQQFNPEKRSEQLRKSWG
VTADTKVLLYVGRLSPEKEVDVLIESHARLYSNKESSPKLVIVGDGPDRLRLQKMVQNSN
VIFTGNLSGEILATTYASADVFTFASQVETFGNVVLEAMASGLPVIAYDYACAHVYVEHG
QTGWLSPLKDIDGLSRAIENLPENAVLRTMGLNARKRVQHAGWQQPVQQLEQALYQVVQE
SVMTT