Protein Info for MPMX26_00413 in Acinetobacter radioresistens SK82

Annotation: Trans-aconitate 2-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01135: PCMT" amino acids 23 to 91 (69 residues), 21.7 bits, see alignment E=5.3e-08 PF13489: Methyltransf_23" amino acids 33 to 182 (150 residues), 59.7 bits, see alignment E=1e-19 PF05175: MTS" amino acids 42 to 107 (66 residues), 23 bits, see alignment E=1.9e-08 PF13847: Methyltransf_31" amino acids 45 to 176 (132 residues), 40.2 bits, see alignment E=1e-13 PF13649: Methyltransf_25" amino acids 48 to 137 (90 residues), 64.3 bits, see alignment E=5e-21 PF08241: Methyltransf_11" amino acids 49 to 135 (87 residues), 47.1 bits, see alignment E=1.1e-15 PF08242: Methyltransf_12" amino acids 49 to 137 (89 residues), 43.4 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: None (inferred from 52% identity to rpx:Rpdx1_0346)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>MPMX26_00413 Trans-aconitate 2-methyltransferase (Acinetobacter radioresistens SK82)
MSDQQYADNIIPIYKKYAIEWDKVRSQHFYEQAWLEQFLNLIPDQSSILDLGCGTGIPTA
QYFSAKKCQITGIDSSAAMLEIARNRFPEHNWLEADMRQLDLKQSFNGIIAWDSFFHLTH
NDQRAMFHIFKKHAKTGTALMLTTGPSHGTALGEMQGEVLYHASLDPDEYKNLFETFGFR
VVNMRFEDPDCARHTIWLAQLM