Protein Info for MPMX26_00341 in Acinetobacter radioresistens SK82

Annotation: Phosphoenolpyruvate-dependent phosphotransferase system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 transmembrane" amino acids 688 to 704 (17 residues), see Phobius details PF13185: GAF_2" amino acids 21 to 158 (138 residues), 54.6 bits, see alignment E=4.1e-18 PF01590: GAF" amino acids 22 to 156 (135 residues), 66 bits, see alignment E=1.6e-21 PF13492: GAF_3" amino acids 22 to 159 (138 residues), 40.4 bits, see alignment E=1.1e-13 PF05524: PEP-utilisers_N" amino acids 183 to 305 (123 residues), 84.1 bits, see alignment E=2.7e-27 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 184 to 737 (554 residues), 425.3 bits, see alignment E=1.8e-131 PF00391: PEP-utilizers" amino acids 332 to 403 (72 residues), 58.8 bits, see alignment E=9.9e-20 PF02896: PEP-utilizers_C" amino acids 431 to 717 (287 residues), 319 bits, see alignment E=8.7e-99

Best Hits

KEGG orthology group: K08484, phosphotransferase system, enzyme I, PtsP [EC: 2.7.3.9] (inferred from 89% identity to abm:ABSDF3103)

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase, nitrogen regulation associated"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (763 amino acids)

>MPMX26_00341 Phosphoenolpyruvate-dependent phosphotransferase system (Acinetobacter radioresistens SK82)
MSNMQLDTLRRIVQEINASVSLHESLEIMVNRVAEAMNVDVCSVYLLDERNQRYLLMASK
GLKPESVGNVSLQVGEGLVGLVGQREEIVNLDNAPKHERFLYLPETGEEIYNSFLGVPVM
YRRKVMGVLVVQNRESQDFSEAAESFLVTLCAQLSGVIAHAHAVGNIDVFRKFNNSTTYK
TFQGVSGAGGIALGRAIILYPPADLAAVPDREAEDISDELNLLDQAVQSVRTEIKALDEK
MQDSLISDERALFSVFLRMLDENALPAEIKELIRNGSWAQGAVRRVIDKHINLFSLMEDD
YLRERVADLKDLGRRILAYLQEAESGHRELSADSILIGEEISTAALVELPVDKIAAIVTS
EGATNSHMVIVARALGIPTVVGVTELPVNTLDDVEMIVDAYQGRVFINPPRRLRQRYKDV
QKEEEQIAKDLKQYETRDAITPDGHVVPLYVNTGLMIDVVRGVQRGAKGVGLYRSEIPFM
LRDRFPGEEEQRAIYRQQLSHFANKPVVMRTLDIGADKDLPYFSIEEENSALGWRGLRFT
LDHPEIFSSQIRAMLKASIGLNNLHILLPMVTSVSEVEEVLYLLERDWVAVQEEEQVKIT
KPKIGIMVEVPSVLLQIDEFADLVDFFSVGSNDLTQYLLAVDRNNPRVANVYSHFHPSVL
RALYRLVGECRKYNKPISICGEMAGDPLSAVLLMAMGFNTLSMSSSNILRVRKAICHTPF
SDAEQLLEEVLRMNNPLVVKSWLEHYFKTHGLTDMVKSSRLVV