Protein Info for MPMX26_00331 in Acinetobacter radioresistens SK82

Annotation: 2,3-dihydroxyphenylpropionate/2, 3-dihydroxicinnamic acid 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF02900: LigB" amino acids 5 to 311 (307 residues), 148.4 bits, see alignment E=1.1e-47

Best Hits

Swiss-Prot: 59% identical to MHPB_PHOLL: 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K05713, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase [EC: 1.13.11.16] (inferred from 59% identity to plu:plu2208)

MetaCyc: 40% identical to 3-carboxyethylcatechol 2,3-dioxygenase (Escherichia coli K-12 substr. MG1655)
3-carboxyethylcatechol 2,3-dioxygenase. [EC: 1.13.11.16]; 1.13.11.16 [EC: 1.13.11.16]

Predicted SEED Role

"2,3-dihydroxyphenylpropionate 1,2-dioxygenase (EC 1.13.11.-)" in subsystem Cinnamic Acid Degradation (EC 1.13.11.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.- or 1.13.11.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>MPMX26_00331 2,3-dihydroxyphenylpropionate/2, 3-dihydroxicinnamic acid 1,2-dioxygenase (Acinetobacter radioresistens SK82)
MPVKLICASHSPLMEFASPQDSSQEQKVRTVFAKLSEQVKAYNPTLIIAFGPDHFNGFFY
DLMPSFCVGIRASAAGDWNYGPGKIDVPEQTALSLVRCVLNEGVDVTYSYRMQADHGVTQ
PLHFLCDGQLDRYPTIPVFVNGAAAPMPTPKRTVALGRAIGQFIKSLDLEAERVLILGTG
GLSHDPPTPQMGAVPPEVEEFLIAGRNPTAEARQARQAKIIAVGQKLAAGDTSVAVPLNA
KWDQALLEKFAQADFAALEAMTEDEIRREGGRGGQEIRCWIAAFAAFAELGQYQMTTHVY
EAISEWIAGFGIVSAELKD