Protein Info for MPMX26_00317 in Acinetobacter radioresistens SK82

Annotation: Ribosomal large subunit pseudouridine synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR00005: pseudouridine synthase, RluA family" amino acids 18 to 306 (289 residues), 262.9 bits, see alignment E=1.8e-82 PF01479: S4" amino acids 22 to 68 (47 residues), 40.1 bits, see alignment 2.4e-14 PF00849: PseudoU_synth_2" amino acids 104 to 248 (145 residues), 103 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 51% identical to RLUC_HAEDU: Ribosomal large subunit pseudouridine synthase C (rluC) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 88% identity to abb:ABBFA_003132)

MetaCyc: 54% identical to 23S rRNA pseudouridine955/2504/2580 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11838 [EC: 5.4.99.24]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>MPMX26_00317 Ribosomal large subunit pseudouridine synthase C (Acinetobacter radioresistens SK82)
MNSTQQWQSVTWFEVDEHQAGQRIDNFLFSRLKGVPKSRIYRLIREGQVRVNKKRIKAES
KLAIGDQVRVAPIRFEPKDETPVPVSDKVAQGLLSRVIYEDEGLMVVNKPSGIAVHGGSG
VAYGLIEGLRAATGKKYLELVHRIDRDTSGLVMISKKRSVLKTLQDLLREHKIKKTYAAI
VKGQVSLDQQLIDAPLYRYELANGERRVRVSKEGKDSKTQWNVAERFMHATLVYASPLSG
RTHQIRVHGLSIGHPLVGDDKYGHETEYKGPKPRRLCLHAIRLEIPGYPTIEAPLPEDMQ
SLAAQLRAQKKD