Protein Info for MPMX26_00309 in Acinetobacter radioresistens SK82

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 205 (190 residues), 163.8 bits, see alignment E=1.7e-52

Best Hits

Swiss-Prot: 52% identical to RHTC_ECO57: Threonine efflux protein (rhtC) from Escherichia coli O157:H7

KEGG orthology group: K05835, threonine efflux protein (inferred from 68% identity to acb:A1S_0877)

MetaCyc: 52% identical to L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-0244

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>MPMX26_00309 Threonine efflux protein (Acinetobacter radioresistens SK82)
MLIALGTLIFIHFCALITPGPDFFLVSQTAISKSRMETFAVVAGISVSVMIWSLLALLGL
NILFEKMAWLKHALLIAGGIYLCWLGFQMLRSAFRKEENNQPVQISLPQSPLSFFLRGLL
TNLSNPKAIIYFGSVFSLFLANPALDHAHGWLLLLVTFETATWFLFVAFVFSLPSFKRAY
QRAAKWIDGISGGIFTLFGSYLILNK